PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC19301_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 83aa    MW: 9658.94 Da    PI: 8.9563
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC19301_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.11.1e-343583452
       zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvG 52
                 +a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvG
  RrC19301_p1 35 TAPPCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVG 83
                 5678********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-203483IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.5993783IPR003851Zinc finger, Dof-type
PfamPF027011.1E-293783IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MMLPYNAHNS YQPQFPSSEI EIPEKWKVPY GHDETAPPCP RCASSNTKFC YYNNYSLSQP  60
RYFCKGCRRY WTKGGSLRNI PVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934723e-61AB493472.1 Arabidopsis thaliana At1g21340 gene for hypothetical protein, partial cds, clone: RAAt1g21340.
GenBankAC0154473e-61AC015447.8 Arabidopsis thaliana chromosome I BAC F24J8 genomic sequence, complete sequence.
GenBankCP0026843e-61CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ4462683e-61DQ446268.1 Arabidopsis thaliana clone pENTR221-At1g21340 Dof-type zinc finger domain-containing protein (At1g21340) mRNA, complete cds.
GenBankDQ6528473e-61DQ652847.1 Arabidopsis thaliana clone 0000013461_0000009694 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149653.17e-56PREDICTED: dof zinc finger protein DOF1.2
SwissprotP683494e-44DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A078IJR18e-56A0A078IJR1_BRANA; BnaA06g15080D protein
STRINGBra017906.1-P2e-55(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.12e-45Dof family protein